Recombinant Mouse C-X-C Motif Chemokine 1,CXCL1,GRO α (C-6His)

Product Name :
Recombinant Mouse C-X-C Motif Chemokine 1,CXCL1,GRO α (C-6His)

Brief Description :

Accession No. :
P12850

Calculated MW :
9.4kDa

Target Sequence :
RLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPKVDHHHHHH

Storage :
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7C for 2-7 days.Aliquots of reconstituted samples are stable at < -20C for 3 months.

Application Details :

Uniprot :
P12850

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
NEDD9 Antibody custom synthesis SCD Antibody Epigenetic Reader Domain PMID:34459894 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

5,8-Dihydroxy-1,4-naphthoquinone

Product Name :
5,8-Dihydroxy-1,4-naphthoquinone

Synonym :

Chemical Name :

CAS NO.:
475-38-7

Molecular formula :
C10H6O4

Molecular Weight:
190.15 g/mol

Classification :
MedChemExpress Products > Research Chemicals > 5,8-Dihydroxy-1,4-naphthoquinone

Description:
5,8-Dihydroxy-1,4-naphthoquinone is a natural compound that is found in the bark of “Nothofagus” species. It has been shown to inhibit the transcriptional activity of NF-κB and AP-1 through its ability to bind to the response element in these promoters. 5,8-Dihydroxy-1,4-naphthoquinone has been shown to be cytotoxic against HL60 cells in vitro. This cytotoxicity may be due to its ability to cause an increase in cytosolic Ca2+ levels by inhibiting the mitochondrial ATPase enzyme. 5,8-Dihydroxy-1,4-naphthoquinone has also been shown to induce apoptosis in fetal bovine retinal cells and neuronal death in rat cortical neurons. It is thought that this drug may have anticancer properties because it triggers DNA damage and inhibits cell proliferation.

Purity :
>98%

Specifications :
10 mM * 1 mL

Price.:
82

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
34233-69-7 Description 2627-69-2 Synonym PMID:29630197 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human ADAMDEC1

Product Name :
Recombinant Human ADAMDEC1

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O15204Gene Accession:BC069582

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O15204

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
ACE Antibody site 2-(4-Boronophenyl)acetic acid site PMID:34993988 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Obeldesivir

Product Name :
Obeldesivir

Synonym :

Chemical Name :

CAS NO.:
2647441-36-7

Molecular formula :
C16H19N5O5

Molecular Weight:
361.35 g/mol

Classification :
MedChemExpress Products > Life Sciences > Obeldesivir

Description:
Obeldesivir, also known as GS-5245, is a broad-spectrum antiviral nucleoside analog targeting the RNA-dependent RNA polymerase (RdRp) of SARS-CoV-2 and other coronaviruses. Its mechanism of action, similar to remdesivir, involves chain termination by incorporation into the viral RNA strand, thereby inhibiting viral replication. Obeldesivir has demonstrated promising in vitro and in vivo efficacy against SARS-CoV-2, with ongoing clinical trials to evaluate its safety and efficacy in humans. It has also demonstrated in some early in vitro and in vivo studies its efficacy against a range of viruses, including filoviruses (Ebola virus), flaviviruses (Dengue virus, Zika virus), and paramyxoviruses (respiratory syncytial virus).

Purity :
>98%

Specifications :
5 mg

Price.:
300

Price unit :
$

Inventory :
In stock

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
84449-90-1 manufacturer 1404-90-6 medchemexpress PMID:28722939 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human RAMP1

Product Name :
Recombinant Human RAMP1

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:O60894Gene Accession:BC000548

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
O60894

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
ADM Antibody Autophagy SUMO 1 Antibody web PMID:34689320 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

8-Methyl chrysophanol

Product Name :
8-Methyl chrysophanol

Synonym :

Chemical Name :

CAS NO.:
3300-25-2

Molecular formula :
C16H12O4

Molecular Weight:
268.26 g/mol

Classification :
MedChemExpress Products > Natural Products > 8-Methyl chrysophanol

Description:
8-Methyl chrysophanol is a natural product that belongs to the group of phytochemicals, and can be isolated from plants. The chemical structure of 8-methyl chrysophanol is similar to that of resveratrol, but it has a methyl group at the C8 position. This compound is used as an analytical standard for HPLC and LC-MS/MS analysis, as well as in research and development for bioactive compounds. 8-methyl chrysophanol is also used for quality control of food products and natural health products.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
979-92-0 supplier 113559-13-0 SMILES PMID:29989767 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human GJA5

Product Name :
Recombinant Human GJA5

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:P36382Gene Accession:BC013313

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
P36382

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
TNFRSF25 Antibody Autophagy Phospho-Rb Antibody Epigenetic Reader Domain PMID:34997541 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

2-(3-Hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid

Product Name :
2-(3-Hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid

Synonym :

Chemical Name :

CAS NO.:
80148-45-4

Molecular formula :
C20H13N3O6

Molecular Weight:
391.3 g/mol

Classification :
MedChemExpress Products > Life Sciences > 2-(3-Hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid

Description:
Tetraacetyl-2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid is an antibacterial agent that inhibits the biosynthesis of 3-hydroxyanthranilic acid, a precursor to coryneform and leishmanial quinolones. Tetraacetyl-2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole-4-carboxylic acid also inhibits the growth of Streptococcus species, Staphylococcus species, and Leishmania major. Tetraacetyl 2-(3-hydroxy-2-(3-hydroxypicolinamido)phenyl)benzo[D]oxazole 4 carboxylic acid has been shown to be active against C16 cells in vitro

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
839712-12-8 site 59-14-3 site PMID:29261906 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

Recombinant Human ANXA7

Product Name :
Recombinant Human ANXA7

Brief Description :
Recombinant Protein

Accession No. :
Swissprot:P20073Gene Accession:BC002632

Calculated MW :

Target Sequence :

Storage :
-20~-80˚C, pH 7.6 PBS

Application Details :

Uniprot :
P20073

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
CLGN Antibody Description RAB24 Antibody In Vitro PMID:35013452 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com

14-Deoxy-11,12-didehydroandrographiside

Product Name :
14-Deoxy-11,12-didehydroandrographiside

Synonym :

Chemical Name :

CAS NO.:
141973-41-3

Molecular formula :
C26H38O9

Molecular Weight:
494.6 g/mol

Classification :
MedChemExpress Products > Natural Products > 14-Deoxy-11,12-didehydroandrographiside

Description:
14-Deoxy-11,12-didehydroandrographiside is an active constituent of the plant Andrographis paniculata. It has been shown to have a dimension of two in two dimensions with a preparative yield of 5%.

Purity :
>98%

Specifications :
null

Price.:
null

Price unit :
$

Inventory :

MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.
Related websites: https://www.medchemexpress.com
624-49-7 MedChemExpress 303760-60-3 medchemexpress PMID:29630235 MedChemExpress (MCE) offers a wide range of high-quality research chemicals and biochemicals (novel life-science reagents, reference compounds and natural compounds) for scientific use. We have professionally experienced and friendly staff to meet your needs. We are a competent and trustworthy partner for your research and scientific projects.Related websites: https://www.medchemexpress.com